PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca013175G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 179aa    MW: 20844.7 Da    PI: 11.2507
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca013175G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.24.9e-1070127562
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      ++ rr+++NRe+ArrsR RK+  +e+L++ +  L  eN++L ++l  l  ++ +++++
  Gh_Sca013175G01  70 RKRRRMISNRESARRSRMRKRNHLENLRNQANRLRIENRELTNRLRFLLYHCHRVRTD 127
                      5789**************************************9998887777776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-1166130IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.79568131IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-868124No hitNo description
SuperFamilySSF579599.64E-1070120No hitNo description
PfamPF001701.8E-770125IPR004827Basic-leucine zipper domain
CDDcd147028.29E-1771122No hitNo description
PROSITE patternPS0003607388IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MLSTVPAIIS SNPMIQSDPF PSLQSAWDCS QLFSNTQSVG PAPIEPNQTQ AHSNSGLDES  60
NQTLSIIDER KRRRMISNRE SARRSRMRKR NHLENLRNQA NRLRIENREL TNRLRFLLYH  120
CHRVRTDNDR LRSESTVLRQ KLSDMHQILL FKQLQQFSSA WPCNNVTVMS EQIPPPLII
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16973RKRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437168.11e-122PREDICTED: basic leucine zipper 43-like
TrEMBLA0A0D2PR621e-122A0A0D2PR62_G
STRINGVIT_00s0541g00020.t012e-53(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.18e-27basic leucine-zipper 5